SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010847 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010847
Domain Number 1 Region: 24-50,99-160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-24
Family Voltage-gated potassium channels 0.0021
Further Details:      
 
Domain Number 2 Region: 170-273
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-19
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010847   Gene: ENSCJAG00000005898   Transcript: ENSCJAT00000011457
Sequence length 334
Comment pep:novel chromosome:C_jacchus3.2.1:4:40354482:40367942:-1 gene:ENSCJAG00000005898 transcript:ENSCJAT00000011457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRQRAGAAAKGRVQGCGCLMSSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSHSFQRD
KWALLENFTCLDRPALDSLIRDIIHAYKNGASLLSNTTSMGRWEFVGSFFFSVSTITTIG
YGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVDHCASRLGVTWQDPGKAQW
LAGSGALLSGLLLFLLLPPLLFSHMEGWSYMEGFYFSFITLSTVGFGDYVIGMNPSQRYP
LWYKNMVSLWILFGMAWQALIIKLILSQLEMPGRVCSCYRHSSEEDFKSQSWRQGPDREP
VSPSPQQGCYPEEPMEIIRHLEPSAQVVGGGKHS
Download sequence
Identical sequences F7HWJ6
XP_002746561.1.60252 ENSCJAP00000010844 ENSCJAP00000010847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]