SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011113 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011113
Domain Number 1 Region: 38-98
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000707
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011113   Gene: ENSCJAG00000006037   Transcript: ENSCJAT00000011730
Sequence length 134
Comment pep:known chromosome:C_jacchus3.2.1:14:99975057:99977515:-1 gene:ENSCJAG00000006037 transcript:ENSCJAT00000011730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFSPVRSVRKSSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQSQTSRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
Download sequence
Identical sequences F7I6I5
ENSCJAP00000011113 ENSCJAP00000011113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]