SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011222 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011222
Domain Number 1 Region: 1208-1363,1399-1478
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-41
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1528-1719,1753-1778
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-37
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 763-910,944-991
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.94e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 129-275,365-434
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.84e-24
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000011222
Domain Number - Region: 1787-1831
Classification Level Classification E-value
Superfamily EF-hand 0.0078
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011222   Gene: ENSCJAG00000006101   Transcript: ENSCJAT00000011842
Sequence length 2003
Comment pep:novel chromosome:C_jacchus3.2.1:6:53618586:53622436:1 gene:ENSCJAG00000006101 transcript:ENSCJAT00000011842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAQKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILSPLNPVRKI
AIKILVHSSTLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGF
CLEDFTFLRDPWNWLDFSVIVMAYICNFQHYGTLRILFSFELLLLGDDHSSLSSGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFEINTTSYFNG
TMDSNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGR
NPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVN
LILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGG
LGELLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSF
LFSMDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDE
HSTFEDSESRRDSLFVPHRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVSLV
GGPSALTSPTGQPLPEGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAMSIASILTNTME
ELEESRQKCPPCWYRFANMFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIVLNTLFM
AMEHYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLM
ELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFA
VVGMQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQ
TMCLIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDY
VKNKIRECFRKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKEFNYLRDGNGTTSGVGTG
SSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNATS
SSEGSTVDVALPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKIWWNLRK
TCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLL
KWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSR
FEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGNMFNVSE
VNNFSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPL
YEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMK
KLGSKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQGKYMTLV
LSRINLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEMIEKYFVSP
TLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF
AYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDTIHPGSSV
KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVW
EKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFT
KRVLGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLK
QRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPD
KEKFEKDKPEKESKGKEVRENQK
Download sequence
Identical sequences F7IN06
ENSCJAP00000011266 ENSCJAP00000011222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]