SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011582 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011582
Domain Number 1 Region: 24-197
Classification Level Classification E-value
Superfamily TIMP-like 2.55e-68
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011582   Gene: ENSCJAG00000006278   Transcript: ENSCJAT00000012218
Sequence length 211
Comment pep:known chromosome:C_jacchus3.2.1:1:195356836:195414447:1 gene:ENSCJAG00000006278 transcript:ENSCJAT00000012218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPWLGLVVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
Download sequence
Identical sequences A0A140C4Q7 A0A286ZZX3 A0A2K5QVR5 A0A2K6SFQ0 B0KWT4 B1MTS7 C8BKC2 M3YLT3
ENSOARP00000019543 ENSMPUP00000012290 ENSCJAP00000011582 NP_001159659.1.54773 NP_001159659.1.66739 XP_002743758.1.60252 XP_003126121.3.46622 XP_003932982.1.74449 XP_004269450.1.21590 XP_004317980.1.83887 XP_004414245.1.74151 XP_004743146.1.14098 XP_005962429.1.78601 XP_007096512.1.5354 XP_007102045.1.24612 XP_007165778.1.59432 XP_007449498.1.90284 XP_012628251.1.48125 XP_017391841.1.71028 XP_017507787.1.32401 XP_017903714.1.57651 XP_019302261.1.44245 XP_021543062.1.83697 ENSTTRP00000006079 ENSTTRP00000006079 ENSMPUP00000012290 9823.ENSSSCP00000000161 ENSCJAP00000011582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]