SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012369 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012369
Domain Number 1 Region: 275-554
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-71
Family Kelch motif 0.0000249
Further Details:      
 
Domain Number 2 Region: 12-132
Classification Level Classification E-value
Superfamily POZ domain 4.71e-34
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012369   Gene: ENSCJAG00000006681   Transcript: ENSCJAT00000013038
Sequence length 558
Comment pep:known chromosome:C_jacchus3.2.1:6:48824746:48877731:-1 gene:ENSCJAG00000006681 transcript:ENSCJAT00000013038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKGQEDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSN
YFKAMFTADMKEKFKNKIKLSGIHHDVLEGLVNYAYTSQIEITKRNVQSLLEAADLLQFL
SVKKACERFLVRHLDIDNCIGMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISL
EKFLFILSRKNLSVWKEEAIIEPVIKWTAHDVENRIECLYNLLSYINIDIDPMYLKTALG
LQRSCLLTENKIRSLIYNALNSMHKEISQRSTATMYIIGGYYWHPLSEVHIWDPLTNVWI
QGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWTEGLPMLNARY
YHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITEC
YDPEQNEWREIAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIV
GNLPSAMRSHGCVCVYNI
Download sequence
Identical sequences F7H8G6
ENSCJAP00000012369 ENSCJAP00000012369 ENSCJAP00000012386 XP_008996983.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]