SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012967 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012967
Domain Number 1 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000136
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 34-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000245
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 196-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 128-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000568
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000012967
Domain Number - Region: 83-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000323
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 243-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00128
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012967   Gene: ENSCJAG00000006974   Transcript: ENSCJAT00000013668
Sequence length 552
Comment pep:known chromosome:C_jacchus3.2.1:15:70700901:70716408:1 gene:ENSCJAG00000006974 transcript:ENSCJAT00000013668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFAKKHQLKVHLLTHGGGQGRRPFKCPLEGCGWAFTTSYKLKRHLQSHDKLRPFGCPVGG
CGKKFTTVYNLKAHMKGHEQESLFKCEVCSERFHTQAKLSSHQRSHFEPERPYKCDFPGC
EKDIITSECLFHNRAHFREQELFCSFPGCSKQYDKACRLKIHLRSHTGERPFVCDSDSCG
WTFTSMSKLLRHRRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFECPVEGCC
ARFSARSSLYIHSKKHVQDVGAPKSRCPVSTCNRLFTSKHSMKAHMVRQHSRRQDLLPQL
EAPSSLTPSNELSSPGQSELTNMDLAALFSDTPANASGSAGGSDEALNSGILTIDVTSVS
SSLGGNLPANNSSLGPMEPLVLVAHSDIPPSLDSPLVIGTAASVLQQSSFNVDDVQTVSA
GALGCLVALPMKNLSEDPLALTSSSNLSVHSTTPTSSSTPRENASVPELLAPIKVEPDSP
RHPKTVGQQEGSHGLPRPMLSSPAEQHGAQDTELSAGTSNLYLESGGSARTDYRAIQLAK
EKKQRGAGSNAG
Download sequence
Identical sequences F6RDG1
ENSCJAP00000012967 ENSCJAP00000012967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]