SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013051 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013051
Domain Number 1 Region: 840-924
Classification Level Classification E-value
Superfamily DEATH domain 6.28e-24
Family DEATH domain, DD 0.0000456
Further Details:      
 
Domain Number 2 Region: 168-260
Classification Level Classification E-value
Superfamily Immunoglobulin 3.21e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 259-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000693
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 313-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000172
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013051   Gene: ENSCJAG00000006998   Transcript: ENSCJAT00000013758
Sequence length 930
Comment pep:known chromosome:C_jacchus3.2.1:3:98302880:98698790:1 gene:ENSCJAG00000006998 transcript:ENSCJAT00000013758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKGLRATAARCGLGLGYVLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
GQSVQKITCTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNTSGAVTPQDELSEFTSKLSPQMTQSLLENEALNLKNQSLARQTDPSCTAFGSFNSLG
GHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGAL
LTRPVILTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHIL
TENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEVLHLRGQ
LGGQLLERTKAHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCTF
TLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPSA
FSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNF
PDGNLSMLAAVLEEMGRHETVVSLAAEGQY
Download sequence
Identical sequences F7A249
ENSCJAP00000013051 ENSCJAP00000013051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]