SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013540 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013540
Domain Number 1 Region: 808-888
Classification Level Classification E-value
Superfamily DEATH domain 7.65e-20
Family DEATH domain, DD 0.00015
Further Details:      
 
Domain Number 2 Region: 241-291
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000876
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 151-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000236
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 295-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 5 Region: 44-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000101
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013540   Gene: ENSCJAG00000007237   Transcript: ENSCJAT00000014262
Sequence length 898
Comment pep:known chromosome:C_jacchus3.2.1:2:62401545:62468834:-1 gene:ENSCJAG00000007237 transcript:ENSCJAT00000014262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRPGLWPALLGIVLSAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKP
VLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLE
EYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE
VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY
VNGGWSTWTEWSVCSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGS
WSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGADLDSRNCTSDLCVHTASGPEDVA
LYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLL
TIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGSGRHTLHHSSPTSEAEEFVS
RLSTQTYFRSLPRGTSNMTYGTFNFLGGRLIIPNTGISLLIPPDAIPRGKIYEIYLTLHK
PEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSW
EDVLHLGEDAPSHLYYCQLEASACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAPVACT
SLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLW
KSKLLVSYQEIPFYHIWNGTQQYLHCTFTLERVSPSTSDLACKLWVWQVEGDGQSFNINF
SITKDTRFAELLALESEGGVPALVGPSAFKIPFLIRQKIISSLDPPCSRGADWRTLAQKL
HLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEAEC
Download sequence
Identical sequences F6ZXV4
ENSCJAP00000013540 ENSCJAP00000013522 XP_003732335.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]