SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014024 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014024
Domain Number 1 Region: 403-576,605-666
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.12e-44
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 670-855
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 38-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.71e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014024   Gene: ENSCJAG00000020150   Transcript: ENSCJAT00000014771
Sequence length 1160
Comment pep:novel chromosome:C_jacchus3.2.1:8:95862108:95879954:1 gene:ENSCJAG00000020150 transcript:ENSCJAT00000014771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RSGRAGGTGAPGAVVVDVDLAPAAPSSESLALDEMTAMDNHVAGLGPAEERRVLVGRGSP
PAPAPGPLPSPPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGALPPP
PRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREII
APKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVI
YTAVFTPYSAAFLLKETEEGPAAPDCGYACQPLAVVDLIVDIMFIVDILINFRTTYVNAN
EEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKL
DRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHVDSRIGWLHNLGDQIGKPYNS
SGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNV
SAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKG
FPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTAL
YFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLL
EVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSAELEGGFSRQRKRKLSFRRRTDKDT
EQPGEVSALGPGRAGAGPSSRGRPGGPWGDSPSSGPSSPESSEDEGPGRSSSPLRLVPFS
SPRPPGELPGGEPLTEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPT
PSLLNIPLSSPGRRPRSDVESRLDALQRQLNRLETRLSADMASVLQLLQRQMTLVPPAYS
AVTTPGPGPTSTFPMLPVSPLPPLTLDSLSQVSQFMACEELPPGDPELPQDGPTRRLSLP
GQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences F7BGZ0
ENSCJAP00000014024 XP_002751887.1.60252 ENSCJAP00000037477 ENSCJAP00000037521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]