SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015611 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015611
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 3.42e-17
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 
Domain Number 2 Region: 847-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000117
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 769-802
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000392
Family CCCH zinc finger 0.0059
Further Details:      
 
Domain Number 4 Region: 905-933
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000432
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000015611
Domain Number - Region: 631-661
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0116
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 505-533
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0487
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015611   Gene: ENSCJAG00000008403   Transcript: ENSCJAT00000016496
Sequence length 972
Comment pep:known chromosome:C_jacchus3.2.1:12:15371525:15415296:1 gene:ENSCJAG00000008403 transcript:ENSCJAT00000016496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLHALVRNLFNEGNDVYRERDWN
NSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGCHDKVLEDCNIVLSLNA
SNCKALYRKSKALSDLGRYRKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNYSVEDIEPDLLTPRQEAVPVVSLPASSFSHEVGSELASVPVM
PLTSVLPLQVEGSALPSSAVLANGGKMPFTMPEAFLDDGDMVLGDELDDLLDSAPETNET
VMPSSLVRGPLQTASVSPSMPFSASLLGTLPIGARYAPPPSFSELYPSLTSSLEDFCSSL
NSFSMSESKRDLSTSTSREGTPLNNSNSSLLLMNGPGSLFASENFLGISNQPRNDFGNFF
GSAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRI
KNVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKG
AFSREAFFGGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTACSHPVT
KHEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELK
VWIMQNETGISHDAIAQESKRYWQNLEANVPGAQVLGNQIMPGSLNMKIKFVCAQCLRNG
QVIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIA
SGKKCQYVGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSQKNEKSEDVASQSNKE
NGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRF
PTGYFSICDRYMNGTCPEGSSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIAPNDND
FGKYSFLFKDLN
Download sequence
Identical sequences F7H9R8
ENSCJAP00000015611 ENSCJAP00000015611 ENSCJAP00000049768 XP_002755967.1.60252 XP_009007443.1.60252 XP_017834231.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]