SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015998 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015998
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.58e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015998   Gene: ENSCJAG00000008704   Transcript: ENSCJAT00000016903
Sequence length 380
Comment pep:known chromosome:C_jacchus3.2.1:5:111455692:111462428:-1 gene:ENSCJAG00000008704 transcript:ENSCJAT00000016903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKSDAPPPPPPAPGAPGPARAAKPVSLRG
DEVPEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSKLR
RQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKR
PDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYPYP
CSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPP
LCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYD
MHLHHDRGPMYEELNAFFHN
Download sequence
Identical sequences F7HEH2
ENSCJAP00000015998 ENSCJAP00000016005 ENSCJAP00000015998 XP_002748570.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]