SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018779 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018779
Domain Number 1 Region: 578-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 661-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 466-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 5-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-18
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 5 Region: 522-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 702-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.39e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 410-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000239
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 372-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000815
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 9 Region: 623-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000137
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 243-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000209
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000018779
Domain Number - Region: 191-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0828
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018779   Gene: ENSCJAG00000010198   Transcript: ENSCJAT00000019836
Sequence length 786
Comment pep:novel chromosome:C_jacchus3.2.1:8:97164360:97185128:1 gene:ENSCJAG00000010198 transcript:ENSCJAT00000019836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRPPKLPLTFEDVAIYFSEQEWQDLQAWQKELYKRVMRSNYETLISLDDGLPKPELIAW
IEQGEEPFRNWRESQKSGNIICSSVDLHLEIGFEEQLFWGDQQAVNSEKTKSHLQLGPLE
SQCSFGSLLGEREAVSFRPDQGITLGSPQRHDARAPPPLACGPSASAQKEGIPGPRNLDL
PGLWDVPAWESTQYPCPVCRESCWENNHLVMNQRGHSKDRLPRAWEKLNKRAETQLPRSC
LWGQKHFRCGACGKSFRRKPYLLRHLAAHTGRGPFQSADSEMCFRRERAYPSNCLRQKPG
QCTLCSKLSLPVDSTQACRCQHSREGLASWREGGGASSSMHSGQKPGSRLAREGSGHQEG
DTEALQHGAEGPCSCPACGERSPTSARLASRCRAHTGEKPFQCPHCPRRFRLRRLLQGHQ
HAHGGERPFSCRKCGKGFAKQCKLAEHVRVHSGEKPFWCAKCGRNFRQRGQLLRHQRLHT
DEKPFQCPECGLSFRLESMLRAHRLRHGGERPFSCSECGRGFTHQCKLREHLRVHSGERP
FQCPECDKCFRLKGILKAHQHTHSKERPFSCRECGKGFTRQSKLTEHLRVHSGERPFQCP
ECDRSFRLKGQLLSHQRLHTGERPFQCPECGKRYRVKADMKAHQLQHSGEMPFSCECGKG
FVKHSKLIEHIRTHTGEKPFQCPKCDKSFRLKAQLLSHQGLHTGERPFHCPECDKNFRER
GHMLRHQRIHRPERPFACGDCGKGFIYKSKLAEHIRVHTKSCPAPGELDIKKRLSQLFAM
IEADWS
Download sequence
Identical sequences F7EB89
ENSCJAP00000018779 ENSCJAP00000018776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]