SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018994 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018994
Domain Number 1 Region: 2999-3257
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-57
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 1267-1532
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-52
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 3 Region: 1890-2150
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-45
Family YWTD domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 1582-1839
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-43
Family YWTD domain 0.0000226
Further Details:      
 
Domain Number 5 Region: 3850-4121
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-43
Family YWTD domain 0.00000572
Further Details:      
 
Domain Number 6 Region: 535-768
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-39
Family YWTD domain 0.0000109
Further Details:      
 
Domain Number 7 Region: 199-468
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-38
Family YWTD domain 0.0000808
Further Details:      
 
Domain Number 8 Region: 2199-2468
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-35
Family YWTD domain 0.000038
Further Details:      
 
Domain Number 9 Region: 1180-1259,1525-1577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 10 Region: 847-889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 11 Region: 3545-3585
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000113
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 12 Region: 928-967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 13 Region: 3629-3674
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 14 Region: 3507-3547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 15 Region: 3587-3623
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 16 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 17 Region: 3339-3383
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 1012-1050
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.000088
Further Details:      
 
Domain Number 19 Region: 2698-2735
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 20 Region: 888-930
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 21 Region: 2565-2605
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 22 Region: 1055-1095
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 23 Region: 2738-2772
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 3418-3456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 25 Region: 2820-2856
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 26 Region: 2605-2644
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 27 Region: 3381-3419
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000114
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 141-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000127
Family EGF-type module 0.004
Further Details:      
 
Domain Number 29 Region: 2778-2812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 30 Region: 3302-3337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 3716-3752
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 32 Region: 2945-2986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000194
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 33 Region: 3263-3318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000003
Family EGF-type module 0.015
Further Details:      
 
Domain Number 34 Region: 1103-1138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 35 Region: 2534-2573
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 36 Region: 801-846
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000374
Family EGF-type module 0.041
Further Details:      
 
Domain Number 37 Region: 1141-1176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 38 Region: 1844-1894
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family EGF-type module 0.012
Further Details:      
 
Domain Number 39 Region: 973-1009
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000115
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 40 Region: 2664-2693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 41 Region: 2153-2200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.012
Further Details:      
 
Domain Number 42 Region: 3670-3708
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 43 Region: 71-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000406
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 44 Region: 3761-3809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000524
Family EGF-type module 0.052
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000018994
Domain Number - Region: 4175-4208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000102
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 3800-3836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000175
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 4246-4281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 485-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000671
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4213-4246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000726
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 4352-4390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00265
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 115-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00268
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 2486-2527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 4129-4161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0678
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018994   Gene: ENSCJAG00000010289   Transcript: ENSCJAT00000020064
Sequence length 4520
Comment pep:novel chromosome:C_jacchus3.2.1:9:45927505:46015926:1 gene:ENSCJAG00000010289 transcript:ENSCJAT00000020064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPWLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTEVCIPMSRCNGVQDCVDGSDEGPHCRELRGNCSRLGCQ
HHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYLL
QPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANET
VCWVHVGDSASQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDID
DRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKL
VDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFEN
YLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACEND
QYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGM
DMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDGI
HNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGW
MYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYD
RIETILFNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGIGGAPPTVTL
LRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGVT
CLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHEHTCPSDRFK
CENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDC
GDRSDESASCAYPTCFPLTQFTCNNGRCININWCDNDNDCGDNSDEAGCSHSCSSTQFKC
NSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRWHC
DGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENCES
LACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAPGE
GIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCR
SLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIY
RGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLL
AGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLTVD
YLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLA
KANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRTVS
CACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDY
DAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKK
QINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSSRTLLFSGQK
GPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIDTMRSQLGKATALAIMGDKLWWA
DQVSEKMGTCNKADGSGSVVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQLCL
PTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTS
LAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWT
DQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGTE
RVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFSVS
VFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNMCAVA
NGGCQQLCLYRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDEHNLNA
PVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRITIVENV
GSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDEC
QNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIE
RCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKHVGSNMKLLRVDIPQ
QPMGIIAVANDTNSSLRLPCLCSRELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQE
DLTCRVREGGRGRGWQCANGECINFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCNN
GRCVSNMLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASD
EMNCSATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGGQWQV
CPLNYFACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDG
SDDCGDGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYN
STCDDREFMCQNRQCIPKHFVCDHDRDCADGSDESPECVSPRRWWEGPCLHWVRHQLTGP
FLSQRPDSQLGGLSTHVVLPLARLGRGDPGLLAGSAGWKAWTCHTPSPRLPVHSAFCRPG
FRLKDDGRTCADVDECGTTFPCSQRCINTHGSYKCLCVEGYAPRGGDPHSCKAVTDEEPF
LIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRRMHLNG
SNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPRAL
VVDVQNGYLYWTDWGDHSLIGRIGMDGSSRSVIVDTKITWPNGLTLDYVTERIYWADARE
DYIEFASLDGSNRHVVLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGTNKTLLIS
TLHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNLCLLSPGGGYKCACPTNFYLGSDGRTC
VSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGICTNPA
FICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPE
VTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCSELPGLEPSSLPSVCCSHHPD
KRPPQWPLSRPPGTLLEGGSSSPYDLCYERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDN
SDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGH
CIPLRWRCDADADCMDGSDEEACSTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSD
ENPEECAQFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAQTTHCKDK
KEFLCRNRRCLSSSLRCNMFDDCGDGSDEEDCSIDPKLTSCTANASICGDEARCVRTEKA
AYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAEG
SEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGTI
SYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEV
AQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNI
QWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYG
VTYINNRVFKIHKFGHSPLVNLTGALSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLSP
SGPVCTCPNGKRLDNGTCMPVPSPTPPPDASRPGTCNLQCFNGGSCFLNARRQPKCRCQP
RYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGYCANNSTCTV
NQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGPRCEVNKC
SRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMT
GPRCEEHVFSQQQPGHMASILIPLLLLLLLLLVAGVVFWYKRRVQGAKGFQHQRMTNGAM
NVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATLYMGGHGSRHSLAST
DEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences F7GPY3
ENSCJAP00000018994 ENSCJAP00000018994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]