SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019498 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019498
Domain Number 1 Region: 80-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000187
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 2 Region: 719-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000139
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 486-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000149
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 4 Region: 536-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000038
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 627-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000277
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 782-806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000283
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 7 Region: 580-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000039
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019498
Domain Number - Region: 138-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00979
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019498   Gene: ENSCJAG00000010553   Transcript: ENSCJAT00000020603
Sequence length 890
Comment pep:novel chromosome:C_jacchus3.2.1:5:57971204:57978776:-1 gene:ENSCJAG00000010553 transcript:ENSCJAT00000020603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGRRLPGSSKSGPGKDGSRKEVRLPMLHDPPKMGMPVVRGGQTVPGQAPLCFD
PGSLASDKTEGKKKGRPKAETQTLRDIPLSLMNAWKDEFKAHSRVKCPNSGCWLEFPSIY
GLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRTWNHLDRPLPAPKPGSISRPV
TISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVTKAMAVTRPVPATKPV
TISRPMPVTRPVPATKPITITKSVPVTKPVPVTKPITVTKLVTVTKPMPVTKPVTVSRPI
VVSKPVTVSRPIAISRHTPPCKMVLLTKSENKAPRAAGRNSGKKRAADSLDTCPIPPKQA
RPENGEYGPSTMGQSSAFQLSANTSSGSLSLGSRPSGGPEALRASGPASPPEEDPERTKH
RRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKARVHRSKKPEGPGPEDVRKKVPAAPIAV
SKEAPAHPAPGGPEEQWQRAIQEHGEAICPTCNVVARKTLVGLKKHMEVCQKLQDALKCQ
HCQKQFKSKAGLNYHTMAEHSGQDPSDTEAYEGGEQEERERLRKVLKQMGRLRCPQEGCG
AAFSSLMGYQYHQRRCGKPPCEVDSPSFPCAHCSKTYRSKAGHDYHVRSEHAAPPPEEPT
DKSPEAEDLLGVERTPSGRVRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARL
NYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGAHLAG
KYRCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLVPKKEKKKNLAGGK
KRGRKPKERLPEEPVPKLPLRRDDWPLGCRDKGARGSTGRKLGASKAPEK
Download sequence
Identical sequences F6QC89
ENSCJAP00000045844 ENSCJAP00000019498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]