SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021927 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021927
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-37
Family SCAN domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 460-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 656-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 404-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 701-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 165-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-17
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 10 Region: 506-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000258
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021927   Gene: ENSCJAG00000011933   Transcript: ENSCJAT00000023179
Sequence length 760
Comment pep:known chromosome:C_jacchus3.2.1:5:77598969:77618693:1 gene:ENSCJAG00000011933 transcript:ENSCJAT00000023179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVSSKRMNSSSRSQILLRWKSDKAQSGPYHVEKEILTSRFLRDTETCRQNFRNFPYPDL
AGPRKALSQLRELCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEEA
VTLVEDLTQILEEEAPQNSTLSQDTPEEDLRGKHAFQAGWLNDLVTKESMTFKDVAVDIT
QEDWELMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVIKEILEGPSPEW
ETKAQACTPVEDMSKLTKEETKTIKLEDSYDYDDRLERRAPGGFWKIPTNERGFSLKSVL
SQEDDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDNKTMYNEGRATFNHVSYGIVHRKI
LPGEKPYKCNVCGKKFRKYPSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTGE
KPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPYK
CLECGKTFSHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNEC
WKVFSQSTYLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKAF
SQSANLTQHHRTHTGEKPYKCNVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGA
NLTQHQRIHTGEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQ
HQRIHTGEKPYACRICGKTFTQSTNLIQHQRVHTGAKHRN
Download sequence
Identical sequences F6PGV3
ENSCJAP00000021927 ENSCJAP00000021927 XP_008995014.1.60252 XP_008995015.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]