SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024539 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024539
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily POZ domain 9.03e-18
Family BTB/POZ domain 0.000064
Further Details:      
 
Domain Number 2 Region: 86-157
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000000000916
Family Skp1 dimerisation domain-like 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024539   Gene: ENSCJAG00000013359   Transcript: ENSCJAT00000025953
Sequence length 161
Comment pep:novel chromosome:C_jacchus3.2.1:3:165500546:165501235:-1 gene:ENSCJAG00000013359 transcript:ENSCJAT00000025953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPSIRLQSSDGEIFGVDVEIAKESVTLKTMLEDLGMDDEGDDDPVPLPNVNATILKRKII
QGCTHHKDDPPPPDDGENKEKQTDTIPVWDQEFLKVDQGTLFKVIVAAHQLDIKGLLDAP
CKTVALITGEAPEEQSSIDTKTDFTNEEAQVPKENPWCKET
Download sequence
Identical sequences F7GSM1
ENSCJAP00000024539 ENSCJAP00000024539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]