SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025661 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025661
Domain Number 1 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000496
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 174-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000026
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 3 Region: 196-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000177
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 4 Region: 309-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000143
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000025661
Domain Number - Region: 128-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0652
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025661   Gene: ENSCJAG00000013942   Transcript: ENSCJAT00000027120
Sequence length 516
Comment pep:known chromosome:C_jacchus3.2.1:11:16763804:16776995:1 gene:ENSCJAG00000013942 transcript:ENSCJAT00000027120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPGKVPRKENLWLQCEWGSCSFVCSAMEKFFEHVTQHLQQHLHSSGEEEEEEEEDDPL
EEEFSCLWQECGFCSLDNSADLIRHVYFHCYHTKLKQWGLQALQSQADLGPCILDFQSRN
VIPDIPDHFLCLWEHCESSFDNPEWFYRHVEAHSLCCEYEAVGKDNPVVLCGWKGCTCTF
KDRSKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQHFQCSHCSKRFAT
ERLLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSEDRPFKCDCCDYSCKNLIDLQ
KHLDTHSEEPAYRCDFENCTFSARSLCSIKSHYRKVHEGDSEPRYKCHVCDKCFTRGNNL
TVHLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLQQPQQGLGLETSLN
ESSLQGIILETVPEEPERKEEEEGKGGEGITLSASQDNPSSVIHVVNQTSAEGQQEIVYY
VLSEAPREPPPAPEPPSGDIMEKFQGIAEEPEIQMV
Download sequence
Identical sequences F7AEP4
XP_002754478.2.60252 ENSCJAP00000025661 ENSCJAP00000025661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]