SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025727 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025727
Domain Number 1 Region: 711-805
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.89e-16
Family Tudor domain 0.0017
Further Details:      
 
Domain Number 2 Region: 577-665
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000025727
Domain Number - Region: 767-877
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0085
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025727   Gene: ENSCJAG00000013990   Transcript: ENSCJAT00000027187
Sequence length 880
Comment pep:novel chromosome:C_jacchus3.2.1:5:100285364:100301183:-1 gene:ENSCJAG00000013990 transcript:ENSCJAT00000027187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTSSMAIQFRSLFPLALPGMLVLLGWWWFFSRKKGHVSSHDEQVEAGAVQLRADPAIREP
LPMEDVHPEVASITPSVTQPPEKELSTLNKLPAEPPALLRTHPPCQKSESSGSLPNTADM
RLRPGTRRDDSAKLELALTGGEAKSIPLECPLSSAKGLLFPHEATEACKQESPFSRVPGR
GQPGYAAAPAEKHGSGERARETGGAEGTGDAVLGETVLEEGLLSREHVLELENSKAPSLA
PLAGEEEKGKSSPPQVVGLMCKEEYVVEKLPSSLIKLAHTGLAKGDEVPAPPVTDSKVQD
RDVEGELGNEDSLDRNEEIEQAAFQIISQVISEATEQVLTTAVSEVSGHVHQASASQLQG
QKEESCVPTHQKTVLGPNTAEPATAEAAAALSDAALPSPGLRAEGSPPPKTYVSCLNSPL
SSPTKDSKPKNSAHHISLAPCPPPTTPGGESLDGVSILVEDATCVSCMSDSSQDVPLVAS
PGHCSDSLSTSGIEDSCTETSSSPRDKAITPPLPESTVPFSNGVLKEELSDLGAEDGWTV
DAEADHSGGSDRNSMDSVDSCCGLKKTESVQNAQAGSNPKKVDLIIWEIEVPKHLVGRLI
GKQGRYVSFLKQTSGAKIYISTLPYTQSVQICHIEGSQHHVDKALTLIGKKFKELNLTNI
YAPPLPSLALPSLPMTSWLMLPDGITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQM
YLCYSQPGIPTLPTPVEITVICAAPGADGAWWRAQVVASYEETNEVEIRYVDYGGYKRVK
VDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDHFSPEADAAMSEMTGNTALLAQVTSYS
PTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYASL
Download sequence
Identical sequences F6X3G3
ENSCJAP00000025727 ENSCJAP00000025727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]