SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027807 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027807
Domain Number 1 Region: 226-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000928
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000519
Further Details:      
 
Domain Number 2 Region: 296-366
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000182
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000027807
Domain Number - Region: 67-180
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0193
Family MBT repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027807   Gene: ENSCJAG00000015063   Transcript: ENSCJAT00000029385
Sequence length 673
Comment pep:known chromosome:C_jacchus3.2.1:5:74222787:74255250:1 gene:ENSCJAG00000015063 transcript:ENSCJAT00000029385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLASGGDVEPGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLP
PPADYNKEITEGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNEIVTLE
RLRPVNPNPLATKGSFFKVTMAVPEDLREACSNENVHKEFKKALGANCIFLNITNSELFI
LSTTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLETSKQLAAAFQEEFTVREDLM
GLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSEDSVQVPR
NLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQAL
LEYHLSYLQEVEQLRLERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYSTDESSSSSLH
ATRTYGGSYGGRGRGRRTGGAAYGPSSDVSTASETESEKREEPNRAGPGDRDPPTRGEES
RRRPIGGRGRGPPPAPRPTSRYNSSSISSVLKDPDSNPYSVLDTSEPEPPVDSEPGEPPP
ASARRRRSRRRRTDEDRTIIDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDG
SISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLPKGPSENGELS
APLELGSMVNGVS
Download sequence
Identical sequences F7GTZ7
ENSCJAP00000027807 ENSCJAP00000027807 XP_002748002.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]