SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030410 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030410
Domain Number 1 Region: 594-789
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-73
Family Sec7 domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 357-540,821-905,1145-1450,1608-1715
Classification Level Classification E-value
Superfamily ARM repeat 1.58e-24
Family Armadillo repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030410   Gene: ENSCJAG00000016470   Transcript: ENSCJAT00000032134
Sequence length 1745
Comment pep:novel chromosome:C_jacchus3.2.1:5:42958529:43040927:1 gene:ENSCJAG00000016470 transcript:ENSCJAT00000032134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEIKAEIEKQRLGTAAPPKANFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHI
TGNAPDSGAPGKRLIDRIVETICSCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTIL
QTVRTCYNIYLASKNLINQTTAKATLTQMLNVIFTRMENQVLQEARELEKPIQSKPQSPV
IQAAAVSPKFVHLKHSQAQSKPTTPEKTDLTDGEHARSDSGKVSTENGDTPREGGSLLSG
TDDGAQEVVKDILEDVVTSAVKEAAEKHGLTEPQRVLGELECQECAIPPGIDENSQTNGI
ADDRQSLSSADNLESDAQGHQVAARFSHVLQKDAFLVFRSLCKLSMKPLGEGPPDPKSHE
LRSKVVSLQLLLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFL
TLLSNFKMHLKMQIEVFFKEIFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNY
DCDLNAANIFERLVNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKD
LYVNPNHQTSLGQERLTDQEMGDGKGLDMARRCSVTSMESTVSSGTQTTVQDDPEQFEVI
KQQKEIIEHGIELFNKKPKRGIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDS
ARFNKEVMYAYVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQ
TLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYE
EIEGKKIAMKETKEHTIATKSTKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAP
FTSATHLDHVRPMFKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLE
RDAYVQALARFSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLE
LAQLIGTGVKTRYLSGSGREREGSLKSHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESV
GETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEIS
YYNMNRIRLQWSRIWVIGDHFNKSQTCNPKATVLTFKLETFLRFGMELILREELCSFLFP
FSKVQIIWLSGSFLRSPTIRDMVIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNI
VELAFQTSCHIVTTIFQHHFPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKY
VSERPRVLQEYTSDDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMK
SYGHTFEKHWWQDLFRIVFRIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEAL
NEVLLSDVFAQLQWCVKQDNEQLARSGTNCLENLVISNGEKFSPEVWDETCNCMLDIFKT
TIPHVLLTWRPAGMEEDSSEKHLDVDLDRQSLSSIDKNPSERGQSQLSNPTDDSWKGRPY
ANQKLFASLLIKCVVQLELIQTIDNIVFYPATSKKEDAEHMVAAQQDTLDADIHIETEDQ
GMYKYMSSQHLFKLLDCLQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLA
CCLRILFRMYVDENRRDSWEEIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKT
LKINDEKFKAHASMYYPYLCEIMQFDLIPELRAVLRKFFLRIGVVYKIWSPEEPSQVPAI
LSPVW
Download sequence
Identical sequences F6UKD9
ENSCJAP00000030410 ENSCJAP00000030399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]