SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030441 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030441
Domain Number 1 Region: 18-191
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-51
Family DBL homology domain (DH-domain) 0.0000353
Further Details:      
 
Domain Number 2 Region: 177-326
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 341-455
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-25
Family DEP domain 0.004
Further Details:      
 
Domain Number 4 Region: 438-529
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.29e-21
Family DEP domain 0.0019
Further Details:      
 
Domain Number 5 Region: 566-641
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000413
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 645-709
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000399
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030441   Gene: ENSCJAG00000016539   Transcript: ENSCJAT00000032168
Sequence length 1594
Comment pep:novel chromosome:C_jacchus3.2.1:5:42642903:42695387:-1 gene:ENSCJAG00000016539 transcript:ENSCJAT00000032168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQAFLHRIRQNVADSVEKGLTEENVKILFSNIEDILEVHKDFLAALEYCLHPEPQSQHE
LGNVFLKFKDKFYVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEG
YLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEAL
EQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGS
KKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWF
VCMAKTAEEKQKWLDAIIREREQRESERLKLGMERDYVMIAEKGEKLYHMMMNKKVNLIK
DRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKQQFKNEQ
VMYRFGMTMVRTRARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLV
DWLLAQGDCQTREEAVALGVGLCNNGFMHHGLAAGEEIEFRDESQYFRSTLMRRTVGTAV
PKREKRRGINPLISSIFLPSRALILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEMAGLQV
GRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLCFQIR
GAAPPYVYAVGRGSEAMAAGLCPGQCVLKVNGSSVMNDATPEVLEHFQAFRSRREEALGL
YQWIYHTHEDAQEARATQEAPSEDPSGERAQEEDQTESAFPLLSLGPRLSLCEDSPVVSL
TVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAADDSIFVENCARL
MALSSAMVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQATLEPHPLCG
LDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCVTT
MAAPSWKCLPVAESDPQGKGLHDSSFVGQEDQGLSFLLKQEDREIQDAYLQLFTKLDVAL
KEMKQYVTQINRLLSTITEPTSGGSCDPSLAEEASSLPLVSEENEMDRSDHGGIKKVCFK
VAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRI
PSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEFKQKEECTIRG
RSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAIFCQA
LVAAVCTFSEQLLAALGYRMHNLGPREEAGNTQSSPSSSHWGVWAQAREAVTLLGPVSEK
EERTMLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQVLRVVFYLDSYHFSK
LPSRLEGGGSLRLHTVLFTKALENVEGLPSPGSQAADDLQQEINVQSLEKVQQYYRKVRA
FYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHSKPGTAGSVGAGLIPISSE
LCYRLGACQMVMCGTGMQSHCRSTLSVSLEQAAILARSHGLPKCIMQATDIMRKQGPRVE
ILAKNLRVKDQMPQGAPRQLQKWKLNSRPVMPDS
Download sequence
Identical sequences F6ZQI7
ENSCJAP00000030441 ENSCJAP00000030476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]