SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030985 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030985
Domain Number 1 Region: 230-323
Classification Level Classification E-value
Superfamily Immunoglobulin 7.24e-20
Family I set domains 0.0065
Further Details:      
 
Domain Number 2 Region: 335-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000671
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030985   Gene: ENSCJAG00000016833   Transcript: ENSCJAT00000032743
Sequence length 852
Comment pep:novel chromosome:C_jacchus3.2.1:2:36734374:36930772:-1 gene:ENSCJAG00000016833 transcript:ENSCJAT00000032743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQVCCSALPPPPLEKARCSSYSDSSSSSERSSSSSESGSSSRSSSNNSISRPAAPLEPR
PQQQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQAYK
TPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCA
PLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQT
GQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDA
GEYVCEAENILGKDTVRGRLYVNSVSTTLASWSGHARKCNETAKSYCVNGGVCYYIEGIN
QISCKCPNGFFGQRCLEKLPLRLYMPDPKQKHLGFELKEAEELYQKRVLTITGICVALLV
VGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNV
PATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIM
LSSVGTSKCNSPACVEARARRAAAYNLEERRRATAPAYHDSVDSLRDSPHSERYVSALTT
PARLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLTEQQPKVRHPAPPGPGP
GPXXGVPEPEPWTGADMQRSYDSYYPARPGPRRGTCALGGSLGSLPASPFRIPEDDEYET
TQECAPPPPPRPRGRGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSAS
ASDDDADGALAAESTPFLGLRAEHDSLRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRG
PPPRAKQDSAPL
Download sequence
Identical sequences F7I3P7
ENSCJAP00000046561 ENSCJAP00000030985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]