SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034041 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034041
Domain Number 1 Region: 590-765
Classification Level Classification E-value
Superfamily PH domain-like 8.47e-36
Family Phosphotyrosine-binding domain (PTB) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034041   Gene: ENSCJAG00000018368   Transcript: ENSCJAT00000035965
Sequence length 777
Comment pep:known chromosome:C_jacchus3.2.1:1:210152669:210161581:1 gene:ENSCJAG00000018368 transcript:ENSCJAT00000035965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYDSDHCEKDSLSLGRSEQPHPICSFQDDFQEFEMIDDNEEEDDEDDEEEEEDEEGDGEG
QEGGDPGSEAPAPRPLIPSPSLEEPQKHRPTTLHLTTLGTQDSLNNNGGFDLVPPASWKE
TVLCSPAQEALRELPGPLPPTDAGPGGAQSPVRPGCDCEGNQPAEPPAPGGTSPSSDPGI
EADLRSRSSGGHGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSSG
RSSHLTNSIEEASSPASEPEPEPEPEPLREPPRRPAFLPVGPDDTNSEYESGSESEPDLS
EDADSPWLLSNLVSRMISEGSSPIRCPSQCLSPAQRQPGEPVSPAGGVAQDSQDPEAATG
PGGVELVDMETLCAPPPLAPAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRA
CSAACSEEEDEEDDEDEEEAEDSVGPPGGRGTGPSAPRDASLVYDAVKYTLVVDEHTQLE
LVSLRRCAGLGHDSEDDSGGEASEEEAGAALLGGSQVPGDSSPDSPDLTFSKKFLNVFVN
TSRSSSENICTPFALVPTGAPQFPRATFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNM
RTGERGVFPAFYAHAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQ
KIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNS
CYFGFITKHPLLSRFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE
Download sequence
Identical sequences F7ABH4
ENSCJAP00000034041 ENSCJAP00000034041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]