SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035541 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035541
Domain Number 1 Region: 338-701
Classification Level Classification E-value
Superfamily SIS domain 4.73e-97
Family double-SIS domain 0.00000075
Further Details:      
 
Domain Number 2 Region: 3-214,269-313
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.39e-49
Family Class II glutamine amidotransferases 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035541   Gene: ENSCJAG00000019141   Transcript: ENSCJAT00000037538
Sequence length 701
Comment pep:novel chromosome:C_jacchus3.2.1:14:37538516:37595562:1 gene:ENSCJAG00000019141 transcript:ENSCJAT00000037538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGVDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDISFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRDRGGSPLLNGVRSEHQLFTDHITILYRTARTQIGSKFT
RWGSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDD
VAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTM
RGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVEL
ASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDC
GVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEV
LSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALQNKKIHMIYLRGNLTSRLKHGPL
ALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHS
VDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences F7I1M2
ENSCJAP00000035541 ENSCJAP00000035541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]