SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037106 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037106
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 7.06e-24
Family Ribosomal protein S18 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037106   Gene: ENSCJAG00000019949   Transcript: ENSCJAT00000039185
Sequence length 258
Comment pep:novel chromosome:C_jacchus3.2.1:4:31035099:31042443:1 gene:ENSCJAG00000019949 transcript:ENSCJAT00000039185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSVLNTLLRRLPMRSLFRGVHRVQVPLQTLCTKALSEEKSLPPVPISPYENEPWKYLE
SEEYQERYGSCPIWADYRRNHKGGVPPQRTRKTCIRGNKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCMRQHKRLTQAIQKARDLGLLSYHIPQVEPRDLDFSTS
HGAVSATLPAPTLISGKPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKVPP
TASAEASSTGQIGPQNAL
Download sequence
Identical sequences F7AFL5
ENSCJAP00000037112 ENSCJAP00000049491 ENSCJAP00000037106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]