SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038570 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038570
Domain Number 1 Region: 49-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000285
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 187-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000152
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 94-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000313
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 128-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000376
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038570   Gene: ENSCJAG00000020737   Transcript: ENSCJAT00000040747
Sequence length 496
Comment pep:known chromosome:C_jacchus3.2.1:5:5085621:5099355:1 gene:ENSCJAG00000020737 transcript:ENSCJAT00000040747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSL
PQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTH
DPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSR
RVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKK
SHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASRDVMGTKAFPGMLPMGMYGA
HIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYLPDKLPKVEVD
SFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGF
LPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFT
SGLSSTTLPRFHQAFQ
Download sequence
Identical sequences A0A2I2Y8A2 F7I6Y0 H2P1L7 Q9UPG8
ENSP00000246229 ENSPPYP00000012179 NP_002648.1.87134 NP_002648.1.92137 XP_002747459.1.60252 XP_002830233.1.23681 XP_005260493.1.92137 XP_011527165.1.92137 XP_011527166.1.92137 XP_018872902.1.27298 ENSCJAP00000038570 gi|4505859|ref|NP_002648.1| ENSP00000246229 ENSCJAP00000038570 ENSPPYP00000012179 9600.ENSPPYP00000012179 9606.ENSP00000246229 ENSP00000246229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]