SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038788 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038788
Domain Number 1 Region: 5202-5360
Classification Level Classification E-value
Superfamily SET domain 9.16e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1420-1480
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000487
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 273-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000031
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1495-1564
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000135
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1374-1428
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000115
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 224-276
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000253
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 2022-2072
Classification Level Classification E-value
Superfamily HMG-box 0.00000223
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038788   Gene: ENSCJAG00000020845   Transcript: ENSCJAT00000040974
Sequence length 5360
Comment pep:novel chromosome:C_jacchus3.2.1:9:37796747:37809229:-1 gene:ENSCJAG00000020845 transcript:ENSCJAT00000040974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKLPGEDKDSEPAADEPAASEDPGATESDLPNPHVGEVSVPSSGSPRLQDTPQDCSG
GPVRRCALCNCGEPSLHGQRELQRFELPFDWPRCPVVSPRGSPGPNEAVLPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPQLCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNSNSEWFENYSLCHRCHKAQGGQPLSS
VAEQHTPVCSRFSPPEPGATPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
EAGVQLEPQLETLQNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPSEESRASPLP
EALHLSRPPEESPLSPPPEESPLSPPPESSPFSPLEESPFRPPEESPPSPALETPLSPPP
EASPLSPPFEESPLSPPPEELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLF
PPFEESPLSPPPEESPLSPPPEASRLSPPPEDSPMSPPPEESPMSPPPEVSCLSPLPEVS
RLSPPPEESPLSPPPEESPMSPPPEASRLSPPPEDSPTSPPPEDSPASPPPEDSLMSLPL
EESPLSPLPEEPHLSTPPEEPQLSLKPEEPHLSPQPEEPNLSPQPEEPHLYPQPEEPRLS
PRPGEPGLSPQHEGPHLSSQPEKLCLSPQTEEPHLSPVPEEPCLSPQPEESPLSSQSEEP
RLFPQPEELHLSPQPEEPPLSPRSEEPPEEPGQCPVPEELPLFPPPEEPPLSPLLGEPAL
SEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIIPAVAPPALSPLRELEYP
FGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPVGPASLILMEPL
PPQCSPLLQHSLPPQNSPPSQCSPPALPLSVPSPLSPIGNAVGVSDEAESHKMDTEKVPE
PECPALEPSATSPLPSPMGDLSCPAPSPAPALDDFSGLGEGIAPLDGIDAPGSQPEAGQT
PGSLASELKGSPVLPDPEELAPVTPMEVYSECKQAAGQGSPCEEQEEPRASVAPTPPTLI
KSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLC
TDSLPETDDSLLCDAGTAISGGKADGEKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHG
GRGRGRARLKSTASSIETLVVADIDSSPSKEEEEEDDDTMQNTVVLFSNTDKFVLMQDMC
VVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPS
RLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGP
CASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYV
VKPVVPVAPPELVPMKVKEPEPQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRLGL
PGEAGLEGSEPSDALGPDDKKDGDLDTDELLKSEGGVEHMECEIKLEGPVSPDVEPGKEE
TEESKKRKRKPYRPGIGGFMVRQRKSHTRMKKGPAAQAEVLSGDGQPDEVTPADMPAEGV
VEQSLAEGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSRKALFAVGMGRPGFG
LGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDP
EKPGTPGEGMLSSDLDRISTEELPKMESKDLQQLFKDVLGSEREQHLGCGTPGLEGSRTP
LQRPFLQGGLPLGSLPSSSPMDSYPGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTT
PSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSS
RCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINKQTKVGDIARKTDRP
ALHLRIPPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGSVPGPDSPGELF
LKLPPQVPAQVPSQDPFGLAPTYAEPRFPTAPPTYTHYPSPTGAPVQPPILGTSSRPGTG
QPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGKASEPLLSPPPFGES
RKTLEVKKEELGASSPSYGPPNLGFVDSPSSGPHLGGLELKTPDVFKAPLTPRASQVEPQ
SPGLGLRPQEPPPAQALVPSPPSHPDIFRPGSYPDPYAQPPLTPRPQAPPPESCCALPPR
SLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRD
PFAPLHKPPRPQPPEVAFKAGSLAHTPLGAGGFPAALPSGPAGELHAKVPSGQPPNFVRS
PGTGAFVGTPSPMRFTFPQAAGEPSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNYA
VATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPVPDGSLPYLSHGASQRSGITSP
VEKRQDPGAGMGSSLATPELPGTQDPGMSGLSQTELEKQRQVSYNRKCKTKQQIQRNTLR
QEKETAAAAAGAVGPPGSWSAEPSSPAFEQLNRGQTAFAGSQDKSSLVGLPQSKLSGPIL
GPGSFPSDDRLSRPPPPATPSSMDVNTRPLVGGSQAFYQRAPYPGSLPLQQQQQQLWQQQ
QATAATSMRFAMSTRFSSTPGPELGRQALGSPLTGIPTRLPGPGEPVPGPAGPAQFIELR
HNVQKGLGPGGTPFPGQGPPQRPRFYPVSEDSHRLAPEGLRGLAISGLPPQKPSGPPAPE
LNNSLHPTPHTKGPTLPTGLELVTRPPSSMELGRPTPLALEAGKLPCEDPELDDDFDAHK
ALEDDEELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLNGDEFDLLAYTDPELDTGDK
KDIFNEHLRLVESANEKAEREALLQGVEPGPLGPEERPPPAADASEPRLASVLPEVKPKV
EEGGRHPSPCQFTIGTPKVEPASAANSLGLGLKPGQSMMNSRDTRMGTGPFSSSGHTAEK
GSFGATGGPPAHLLTPSPLSGPGGSSLLEKFELESGALTLPGEPAASGDELDKMESSLVA
SELPLLIEDLLEHEKKELQKKQQLSAQLQPQQQQQQQQQQHSLLSTPGPAQAMSLPHEGS
SPNLAGSQQQLSLGLGGARQPGLAQPLMPTQPPAHALQQRLAPSMAMVSNQGHMLSGQHG
GQAGLVPQQSSQPVLSQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIID
PIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPGSDLQNHVAAGSGQER
SAGDPSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKAL
CAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQ
QQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLPGHGLQPPQGPPGGQAGGLRLPPGGMAL
SGQPGAPFLNTALAQQQQQQHSGGAGSLAGPSGGFFPGNLALRGLGPDSRLLQERQLQLQ
QQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQGPGVQTNQALGPKPQGLLPPSSHQG
LLVQQLSPQPPQGPQGILGPAQVAVLQQQHSGALGPQGPHRQVLMTQSRVLSSPQLAQQG
QGLMGHRLVTAQQQQQQQQQHQQQGSMAGLSHLQQGLMSHSGQPKLSTQSMGSLQQLQQQ
QQQQQLQQQQQLQQQQQLQQQQQLQQKQQLQQQQFQQQQQQQQQQQQQMGLLNQSRTLLS
PQQQQQQQVALGPGMPVKPLQHFSSPGALGPTLLLTGKEQNTVETAVSSEVTEGPSTHQG
GQLAIGTTPESMGTEPGEVKPSLSGDSQLLLVQPQAQPQPSSLQLQPPLRLPGQQQQQVS
LLHTAGGGSHGQLGSGSSSEASSVPHLLAQPSVSLGEQPGPMTQNLLGPQQPMLERPMQN
NTGPQPPKLGPVLQAGQGLPGVGVMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLQALL
MQRQLQQSQAVRQTPPYQEPGTQASPLQGLLGCQPQPGGFPGSQTGPLQELGAGPRPQGP
PRLPAPPGALSTGPVLGPVHPTPPPSSPQEPKRPSQLPSPSSQLPTEAQLPPTHPGTPKP
QGPTLELPPGRVSPAAAQLADTLFGKGLGPWDPPDNLAEAQKPKQSSLVPGHLDQVNGQV
VPEAPQLSIKQEPRKPAITANFSLFAPFGSGCPVNGQSQLKGAFGSGALPTGPDYYSQLL
TKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTPSEELGEHPKDAASARDTEGALRDTTEV
KSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPHLGSGRWE
QEDRALSPVIPLIPRASIPVFPDTKPYGALDLEVPGKLPATTWEKGKGSEVSVMLTVSAA
AAKVPWNFLLKKAEVRESLEPRRRSQIVPLDPAWGTERDSVSKNKKEKEKRLRVAQRMRR
PFGRVGGLLGGWDMGKKELGTLLQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPP
PSPLAPSPASPPAEPLVELPTEPLAEPPIPSPLPLASSPESARPKPRARPPEEGEDSHPP
RLKKWKGVRWKRLRLLLTIQKGSGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHE
EGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQR
TGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYI
ERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYW
SLRTNNRRCCYRCSIGENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKE
ADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTG
CARSEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKN
NVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINN
EHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFE
DDQHKIPCHCGAWNCRKWMN
Download sequence
Identical sequences F7IDR1
ENSCJAP00000038791 ENSCJAP00000038788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]