SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043036 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043036
Domain Number 1 Region: 37-377
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.52e-60
Family WD40-repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 374-420
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000011
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043036   Gene: ENSCJAG00000009335   Transcript: ENSCJAT00000057518
Sequence length 421
Comment pep:novel chromosome:C_jacchus3.2.1:9:108686834:108707125:-1 gene:ENSCJAG00000009335 transcript:ENSCJAT00000057518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVDEGSRLLRGTGTDEAVAPEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAW
SQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWP
SPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTP
SGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFL
WSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHPRVG
PAMDDGDVHIGSLRSVGFSPEGLYLAPVADDRLLRIWALELKTPIAFAPMTNGLCCTFFP
HGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRT
F
Download sequence
Identical sequences F7IF01
ENSCJAP00000043036 ENSCJAP00000017149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]