SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043518 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043518
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.52e-21
Family Ubiquitin-related 0.0000121
Further Details:      
 
Domain Number 2 Region: 264-326
Classification Level Classification E-value
Superfamily XPC-binding domain 3.14e-17
Family XPC-binding domain 0.0000425
Further Details:      
 
Domain Number 3 Region: 352-392
Classification Level Classification E-value
Superfamily UBA-like 0.00000000511
Family UBA domain 0.00077
Further Details:      
 
Domain Number 4 Region: 167-222
Classification Level Classification E-value
Superfamily UBA-like 0.0000415
Family UBA domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043518   Gene: ENSCJAG00000031184   Transcript: ENSCJAT00000060051
Sequence length 394
Comment pep:novel scaffold:C_jacchus3.2.1:GL286695.1:20029:21397:-1 gene:ENSCJAG00000031184 transcript:ENSCJAT00000060051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVTLKTLQQRTFKIDIDPEERVKALKEKIESEKGKDAFPVAGQKLIYAIKILNDDTALK
EYKIDEKNFVVLMVTEPKAVSTPAPATTPDSTTAVTSSMVTTVAQAPTPPALAPTSTPTS
VTPASATASPEPAPASATKQEKPAEKPAETPVATTSTDSTSGDSSLSNLYEDATSALVTG
QSYENMVTEVMSMGYERASNCSPESSFNNPDRAVEYLLMGIPGDTENQAVVDPSQAASTG
APPSSAGAAAAATTTATTTTTSSGGHPLEFLQNQPQQIIQQNPSLLPALLQQIGRENPQL
LQQISQYQERFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVGKRSYIERLKA
LGFPEGLVIQVYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences H9KY13
ENSCJAP00000043518 ENSCJAP00000043518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]