SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045383 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000045383
Domain Number - Region: 26-89
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00014
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045383   Gene: ENSCJAG00000033909   Transcript: ENSCJAT00000063642
Sequence length 116
Comment pep:known chromosome:C_jacchus3.2.1:8:114653357:114653707:1 gene:ENSCJAG00000033909 transcript:ENSCJAT00000063642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMVTLPEHRNIPRWVKVIKDMKDPEMFQVQTRLLEVIFGQEGYRIPYIEQVSQAMLKLKA
LESLDFTKVVVYGSYIYKLRAQWMFQSMAEWHQRQEQGMLQLEEAKNALELGSWMK
Download sequence
Identical sequences F6SJ60
ENSCJAP00000045383 ENSCJAP00000045383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]