SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046401 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046401
Domain Number 1 Region: 50-108
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000109
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046401   Gene: ENSCJAG00000034519   Transcript: ENSCJAT00000054469
Sequence length 414
Comment pep:novel chromosome:C_jacchus3.2.1:22:37807870:37830243:1 gene:ENSCJAG00000034519 transcript:ENSCJAT00000054469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRTLVLCSLLKGEDKVSLSQPHGLRVEEKWSNAEFGFGCPNQNLLLSPNRKQRKNHTSKL
QELALLLPIGLKTKKLTKKEILMHILQYIQYLQRNIDAAKALLKCHTTNVEGVLAGLGQN
PASGPARRRRHSTPSSSPSSQKSRLQGACQKPRKKKLTQMSDPEKTRTPKSRRFLALNKP
EKLVTPSPDQKGRGTGGTTTPPRCPDSCGHPRPASSSPPGDRKEGPRPKALLDLTLLDLA
EDTIHCGISSCWCQDSVQDDTPSPALLAQEDAERIHFLNKTQPHPRQLLMFHDSSHDVDE
RSLDVDPWLPAWTPEDSPQVSPLSLGPPHIDVWSTAGHPSEILRLSPSLFSSPGKLLPDE
LLEDGTEYLTQAALFEEVRLDLESSPSAYMQEAPQEKDTPAKAPEDPLEPHSLP
Download sequence
Identical sequences F7HNA5
ENSCJAP00000046401 ENSCJAP00000046401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]