SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051264 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051264
Domain Number 1 Region: 56-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000118
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051264   Gene: ENSCJAG00000012515   Transcript: ENSCJAT00000055326
Sequence length 333
Comment pep:novel chromosome:C_jacchus3.2.1:8:110932879:110960240:-1 gene:ENSCJAG00000012515 transcript:ENSCJAT00000055326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPLEADKIVFLLSRVKRNITLQLIMATPEESSNPHESMTPQLPAQPQDLDSRVARRRLS
QARHRATLAALFDNLRKTVYSQSDLTASKWQVLNKAKSYIPELEQTLDNLLKLKVSLNLE
DGHASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIVSLQEGALPIV
SAAISHLWQNLSEERKASLRQAWAQKHRDPASLAGACREAACAEGSMKDSGVDSQGASCS
LVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASSNPENPEEKFQLYMQIINFFKGL
GCANTRVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences F7IFD5
ENSCJAP00000022923 ENSCJAP00000051264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]