SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051772 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051772
Domain Number 1 Region: 365-598
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 1080-1162,1214-1368
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.9e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 2-134,183-254
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.3e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 794-915,955-1033
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.65e-26
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000051772
Domain Number - Region: 742-794
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000204
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number - Region: 1373-1520
Classification Level Classification E-value
Superfamily EF-hand 0.019
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051772   Gene: ENSCJAG00000000732   Transcript: ENSCJAT00000058125
Sequence length 2027
Comment pep:novel chromosome:C_jacchus3.2.1:9:14070188:14315267:1 gene:ENSCJAG00000000732 transcript:ENSCJAT00000058125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKAD
GANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVI
IIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCRPGWDGP
KHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNL
VLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEE
KPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRA
AVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLG
LQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSN
LVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTV
FQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADA
ESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEESKEEKIELKSITADGESPPTT
KINMDDLQPNENEDKSPYPNPETTGEDDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASA
FFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIV
FTTIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSV
SLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLL
QFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFD
NVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMN
IFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNST
YFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYF
SDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQC
SPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLF
FIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKC
APESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGP
HHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLN
SDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDD
EVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISG
DLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHIN
KAGSSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRLPRPTGHPSTVSTV
EGHGPPLSPAIRVQEVAWKLSSQRCHSRESQTAVVGQEETSQDETYEVKMNDDTEACSEP
SLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRTASLGRRASFHLECLKRQKDRA
GDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPT
LRLEGAESIEKLNSSFPSIHCGSWAETTPCGGGSSAARRARPVSLTVPSQAGAPGRQFHG
SASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPN
GALLPFVNCRDAGQDLAGGEEDAGCVLARGRLSEEELQDSRVYVSSL
Download sequence
Identical sequences F6X7H6
ENSCJAP00000001424 ENSCJAP00000051772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]