SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|53453|gm1.6670_g from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Catan1|53453|gm1.6670_g
Domain Number 1 Region: 58-86,116-216
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000523
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|53453|gm1.6670_g
Sequence length 330
Sequence
MQLSAAGVPPLALKIAATALPRKYTQAAIDVASANGHVETFNWWFKQPFLIPSFSPAAIE
LASPNGHIPCLEFWEARVADGSMLSGGAFRASGPTYLAIYFATAKTRNQSQSRSFSYARL
AREACRNGHVPIFDWILKRVDDHTSWATASDVVPLMACVPVAVLCGQVEVVKWLQDKMGD
SLSLPQTAFADAMARASAPRNNATFLDALVHLGHFSLAAWYLDHWLPRTIGTAVCFNHIT
DKLLRAAIAAQAFNLLDVGSNQAVRIIKGQQPALFMSQPPAPIPFSSAGVIALVDVESSS
VCAIASAGNLPAVREWWWVKEFGDIGLSSD
Download sequence
Identical sequences A0A1Y2H8D4
jgi|Catan1|53453|gm1.6670_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]