SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|58581|gm1.11798_g from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Catan1|58581|gm1.11798_g
Domain Number 1 Region: 56-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000805
Family Thioltransferase 0.05
Further Details:      
 
Domain Number 2 Region: 272-322,387-420
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000148
Family UBX domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|58581|gm1.11798_g
Sequence length 422
Sequence
MSVLSKLLTVPYHVLASLYAVLATLLPFLPKLGRPRHTLLSGTDTQLGGATYDHAVARYD
KLYTSQHPPFYRGSYRQLVDDVKQKLEFALVYLHSEDHDSTERFCTETLADAEFAALLAE
HRINLYYGPMDHPEPYEVSSLLTATSYPFLALITLNSIHGVTKPTVVFRSEGYVPAATLV
AKLRDAVQTHGLFVATIRQEREQREAERRMRAMQDEAYQASLARDRERQRQAEQEAERKR
KAEEDKRQKRAALIQQLRDRKAKRAALRATYSPTTEPTSATPNRTLVQVRLPNGSRVRRA
FVDSDPVRHLYEYVESLDPLGEDELNEEKWADDQVEREERRSARQAARASKAAKGADAAT
AAAAAAASSSSSSSEGEDGDDEQVAGGFKFVLVDVFPRKEHRDVAMSIAEAGLKGGNVVV
EI
Download sequence
Identical sequences jgi|Catan1|58581|gm1.11798_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]