SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|60855|fgenesh1_pm.11_#_27 from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Catan1|60855|fgenesh1_pm.11_#_27
Domain Number 1 Region: 291-431
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.25e-55
Family P-domain of calnexin/calreticulin 0.000000716
Further Details:      
 
Domain Number 2 Region: 85-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-49
Family Calnexin/calreticulin 0.00000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|60855|fgenesh1_pm.11_#_27
Sequence length 652
Sequence
MPRRSTTTTSTKKVAALAALAAVAIGAAAADSASPDLKVEDVQAPPPSSPPTSGESKADK
IAKLTPKEPWTPSSVKLPANTLADQFASRADFEAHWVPSRTQKEDVPAGSDDKDKDLWRY
RGNWAVEEPEAIKGSGPGDLGLVMQSPAAHHAISRKLPAPVAFKGKDLVTVQYEVKLQNG
LECGGAYLKLLSHDAKFDPAKFSDKSPYTIMFGPDKCGATNKVHFIFRHKNKRTGEVKEH
HLRNPPSVPSTFSKESHLYTLLVHPELNTYEIKIDNESKQKGSLLDDFEPPVVPLKEIDD
PKDSKPADWVDEAKIPDPDAKKPADWDEDAPLEIEDADAKQPDDWLADEPEYVADPDAKK
PEDWDDDEDGEWTAPTVPNPKCAEVSGCGEWKRPMIKNPLYKGKWTAPLIDNPKYKGVWK
PRKIANPEYVDEKHPGHMTPIGAVGLELWTMQDKILFDNIVVSDSLTPEQLAAWTKDTWV
KKHDVEMALIKVEEPETVAEDADKAKQASPTDPLDWKAQFALKGLQTFASTLFTNPSKAV
AQFPLVVGALGAMVAVLVTLLVGALFGGSSASVPAKPSSAAAAKAKAKKAAAEKKANGAS
SSSSASEAEAEEDDESEVAAKASGKKEAGTARKRQASKKEESNSQVADKDDE
Download sequence
Identical sequences jgi|Catan1|60855|fgenesh1_pm.11_#_27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]