SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|81820|estExt_fgenesh1_pm.C_170050 from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Catan1|81820|estExt_fgenesh1_pm.C_170050
Domain Number - Region: 17-40
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0131
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|81820|estExt_fgenesh1_pm.C_170050
Sequence length 72
Sequence
MLPLRRRSHRPLPLKASSTALRHAARFGSVDVLEWWFRVGLIRCDKDLAATATLRSLLER
QFWAYRKLPGKH
Download sequence
Identical sequences A0A1Y2HEX3
jgi|Catan1|81820|estExt_fgenesh1_pm.C_170050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]