SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cd36_85270 from Candida dubliniensis CD36

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cd36_85270
Domain Number 1 Region: 499-580
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000011
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 2 Region: 290-367
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000182
Family Eukaryotic type KH-domain (KH-domain type I) 0.0084
Further Details:      
 
Weak hits

Sequence:  Cd36_85270
Domain Number - Region: 623-675
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0258
Family Eukaryotic type KH-domain (KH-domain type I) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cd36_85270
Sequence length 960
Comment |||uncharacterized protein yll032c homologue, putative|Candida dubliniensis|chr 3|||Manual
Sequence
MSNTVVLNLDYTFVIDPKYNNNEIITCYETHNGIWRQYTSKSTSSSSSSSSTGYKMIDNL
YPLQQIAETINNNSNSNCNSVTVLDPSINNPLITVSINGDEKFVNDARHQILINYNRVGY
KTLTLIEIEFMNINETFTDEMMKLCQRYEVEIIINNEINSFNKPSLSQKLDVEREQQQQQ
QLYSIHIVGKLDNITFCETAMRILIDSILNGYTIDCIDMELSMIPILGGIDLFNFHQIAK
QTKANIYVPDLLPNLFNSKIVTNNKDLKIWITAKNITELLLTKFILNKLIQNNHNHLITE
KIIMNKDKLDLMILNNQKNLLNIMFKYGVFIQLPNLGELNNSTVMVQGGNKESVDDCISD
INGIATNYYTVDAIIPNIVNELGLVQLIQRKKTCNAVMNQYGLQINGHCDEIKLILKNLV
ANGNKGNICLAIKLRLELGNDQRDFISGKKNGKLIKILNQLQNIPKINFQNFNQYNFYID
IELTCQTILILKTLELLELELPLELKFNIPEVFHKSIIGNGGSIIQSIMKKYNVFIKFST
IKTCSSNVYSLKRINNVLIKCPRKNSKNIKLVKYEIDQLVYKCCMNDCSINPITPITTVY
HSIKFQLLKSHYLMLINNNKLGQINKLENDYQSFINFPTSIEDFNPTDNKLLIDIKGSES
KIKHCAKQLKKILPNNYEFKVTFNPTKFHDIFMINKQIFENQIVIPFKILLGIEIIANET
PIESSNVDIDNDRVEPYHQFILSYFNENENEKESQSNLDKAIVSLTLFLREQGFLINEKR
SMEFNPLIEPVVSTSPVKLQQSLFNPISPLPLQSITNFIDMRATPTTTKGVVSPHKNSTQ
LQLPVKLQFLPGKNNNNNYHQSRHQRHQSLCLPVKQQPYYLPTKQQFLPSKMQQYQYQQQ
QYQYQYQYQHLPIKQYSPIKQPNFQQFYIPSPTETLVPTTPTTSTSTSTTNTMTPYIYSI
Download sequence
Identical sequences Cd36_85270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]