SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hs20561160___KOG0985 from Core Eukaryotic Genes 458

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hs20561160___KOG0985
Domain Number 1 Region: 5-329
Classification Level Classification E-value
Superfamily Clathrin heavy-chain terminal domain 2.75e-142
Family Clathrin heavy-chain terminal domain 0.0000000000475
Further Details:      
 
Domain Number 2 Region: 444-779
Classification Level Classification E-value
Superfamily ARM repeat 5.47e-99
Family Clathrin heavy-chain linker domain 0.00036
Further Details:      
 
Domain Number 3 Region: 332-487
Classification Level Classification E-value
Superfamily ARM repeat 1.9e-56
Family Clathrin heavy-chain linker domain 0.000000322
Further Details:      
 
Domain Number 4 Region: 887-1045
Classification Level Classification E-value
Superfamily ARM repeat 8.34e-35
Family Clathrin heavy-chain linker domain 0.04
Further Details:      
 
Domain Number 5 Region: 1037-1198
Classification Level Classification E-value
Superfamily ARM repeat 1.53e-30
Family Clathrin heavy chain proximal leg segment 0.0074
Further Details:      
 
Domain Number 6 Region: 796-888
Classification Level Classification E-value
Superfamily ARM repeat 0.00000213
Family Clathrin heavy chain proximal leg segment 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hs20561160___KOG0985
Sequence length 1285
Sequence
MAQILPVRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLVGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCICMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSRMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLHAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYKGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYRNNLQRYIEIYVQKVNPSRTPAVIGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVCRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDALDIASIAVSSALYEEAFTVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLAQAQLQKDLVKEAINSYIRGDDPSSYLEV
VQSASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRVSELEDFINGPNNAHIQQ
LETAVTRRECTRLPSCSIAMFLTLPAWLPPWFTSVSIRQQWTTAARPAAPGRGRRCALPA
WMDKSSASHSCVVFTSSFMQMSWRS
Download sequence
Identical sequences Hs20561160___KOG0985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]