SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC3G9.09c___KOG2916 from Core Eukaryotic Genes 458

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC3G9.09c___KOG2916
Domain Number 1 Region: 181-297
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.22e-40
Family eIF-2-alpha, C-terminal domain 0.0000267
Further Details:      
 
Domain Number 2 Region: 90-177
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.57e-31
Family eIF2alpha middle domain-like 0.0000475
Further Details:      
 
Domain Number 3 Region: 13-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.72e-16
Family Cold shock DNA-binding domain-like 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC3G9.09c___KOG2916
Sequence length 306
Sequence
MSTTSCRMYENRFPEVDELVVVNVRQIQEMGAYVKLLEYDNIEGMVLLSELSRRRIRSVQ
KHIRVGRNEVVVVLRVDKEKGYIDLSKRRVSPEDVVKCEERFNKSKAVHSIMRHIAEKHN
VPLETMYTTIGWPLYRKYGHAYDAFKLAISNPDHVFEGLEPPKSGVINDLLAQISRRLTP
QPIKIRADVEVTCFGYEGINAIKAALKAAEDVHTEEVPIKVKLVAPPLYVLLTNALDKSL
GLKKLEEAIGAIEKSITASNGTCTVKMKPKAVSETDELELADLMKKFEKENAEISGDEED
DQSGSE
Download sequence
Identical sequences P56286
SPAC3G9.09c NP_594081.1.19918 SPAC3G9.09c___KOG2916 SPAC3G9_09c.1 4896.SPAC3G9.09c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]