SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7290321___KOG1750 from Core Eukaryotic Genes 458

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7290321___KOG1750
Domain Number 1 Region: 36-139
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.66e-37
Family Cold shock DNA-binding domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7290321___KOG1750
Sequence length 140
Sequence
MNFLRQSFGITKQLASQAIQCSYETAVRGMASLQQMHRSGPHIKTRPPRQPLDGKPFAKG
VVLKTLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNLQEHNIVLCRVGRLQDVPG
VKLKAVRGVYDLAHVVKKSQ
Download sequence
Identical sequences A0A1B2AKT7 P10735
7227.FBpp0070443 FBpp0070443 7290321___KOG1750 FBpp0070443 FBpp0070443 NP_525050.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]