SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7301265___KOG2781 from Core Eukaryotic Genes 458

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7301265___KOG2781
Domain Number 1 Region: 80-258
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.02e-61
Family Brix domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7301265___KOG2781
Sequence length 298
Sequence
MLRKQARQRREYLYNKALTERLKSKQKIQETVVKSINENKAIGSKNVKKSLTAYKSLKYA
DEGVDDRTVNDEYHYAGCEDPKIMLTTSHNPSSRLKMFMKELRLIIPNAQQMNRGNYQLT
TLMHACRANNVTDFLIVHEHRGIPDSLVVCHLPYGPTAFFNISDVVMRHDIPDIGHMSEQ
KPHLIFNNFKTPIGLRTVKILKHLFPVPKENSQRVMSFLNHNDSIIFRHHQYKYVNKELE
LTEVGPRFSLKLYQIKLGTLENIKAADTEWINRPYMNTSQKRLIFSNDPGIINKDTEA
Download sequence
Identical sequences Q9VBY2
NP_651335.2.81976 FBpp0084144 7227.FBpp0084144 7301265___KOG2781 FBpp0084144 FR45 FBpp0084144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]