SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7303497___KOG1728 from Core Eukaryotic Genes 458

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7303497___KOG1728
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily CATH 1.11e-61
Family CATH 0.00000245
Further Details:      
 
Domain Number 2 Region: 66-147
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.79e-26
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7303497___KOG1728
Sequence length 155
Sequence
MADQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWT
GDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHG
DIVTIGECRPLSKTVRFNVLKVSKGQGAKKSFKKY
Download sequence
Identical sequences A0A0J9TZF2 A0A1B2AJL4 B3NS62 Q0E9B6 Q6XHX5
001553281|e4v6wAL1|2.1.1.371|AL:1-155 FBpp0087115 FBpp0087115 FBpp0087114 7227.FBpp0087113 NP_725114.1.81976 XP_001975964.2.56816 XP_002091106.2.41174 XP_016027109.1.80810 4v6w_AL 7303497___KOG1728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]