SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000197 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000197
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.3e-40
Family Enolase N-terminal domain-like 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000197   Gene: ENSCJAG00000000111   Transcript: ENSCJAT00000000209
Sequence length 142
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:57475625:57499027:1 gene:ENSCJAG00000000111 transcript:ENSCJAT00000000209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRGRISRLSVRDVRFPTSLGGHGSDAMHTDPDYSAAYVVIETDAEDGLKGCGITFTLGK
GTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLASDGQLRWIGPEKGVVHLATAAILN
AVWDLWAKQEGKPVWKLLVDMG
Download sequence
Identical sequences F7D9P7
ENSCJAP00000000197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]