SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000271 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000271
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000497
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 82-124
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000248
Family Hairy Orange domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000271   Gene: ENSCJAG00000000166   Transcript: ENSCJAT00000000295
Sequence length 174
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:40802141:40803104:-1 gene:ENSCJAG00000000166 transcript:ENSCJAT00000000295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRRRSNHYAAHRQSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSSYSKLEKADV
LEMTVRFLQELPASSWPMAAPVPCDSYREGYSACVARLAHVLPACRVLDPAVSARLLEHL
WRRAAGATPDGGRAGDSGGPSAPTPASASAPQPASLPMPSPPSPPCGSGLWRPW
Download sequence
Identical sequences F7GEY5
ENSCJAP00000000273 ENSCJAP00000000271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]