SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000273 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000273
Domain Number 1 Region: 13-43
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000989
Family HLH, helix-loop-helix DNA-binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000273   Gene: ENSCJAG00000000166   Transcript: ENSCJAT00000000298
Sequence length 74
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:40796001:40808198:-1 gene:ENSCJAG00000000166 transcript:ENSCJAT00000000298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGREDASCWQLPLHSQN
RLLLSIQAPEQPPA
Download sequence
Identical sequences F7GEV3
ENSCJAP00000000273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]