SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000286 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000286
Domain Number 1 Region: 494-527,566-632
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000883
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000286   Gene: ENSCJAG00000000159   Transcript: ENSCJAT00000000312
Sequence length 661
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:43035264:43193574:1 gene:ENSCJAG00000000159 transcript:ENSCJAT00000000312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKKSMLWSKMHTLQCEDIIQWCRRRLPILDWASHYNLKENLLPDTVSGMMLALQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERIVP
QNIQNLTTQSNTSVLGLSDFEMQRIRVAAAVSFLGGVIQVAMFVLQLGSATFIVTEPVIS
AMTTGAATHVVTSQVKYLLGIKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMSILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTLSI
KNMKEMEFKVKTEMESETLQQVKIISINNPLVFLNAKKFYTDLMNIIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEALQSCPNEKNSLILDCSGFTFFDYSGVSMLVEVYMDCKGR
NVDVLLAHCTASLIKAMKYYGNLDSEKPIFFESVSAAISHIHANKVRYIYNNLDLPTMSL
L
Download sequence
Identical sequences F7G2J9
ENSCJAP00000000286 ENSCJAP00000000284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]