SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000368 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000368
Domain Number 1 Region: 60-100,168-245,287-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000272
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000000368
Domain Number - Region: 56-105,292-361,415-526
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0083
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000368   Gene: ENSCJAG00000000220   Transcript: ENSCJAT00000000400
Sequence length 550
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:41681074:41704807:1 gene:ENSCJAG00000000220 transcript:ENSCJAT00000000400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLAGHFRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSVT
FPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTVLHSKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNMEG
SMLTISFGSWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFRENT
YITSISRLYRDQDDDNNQDRDISTKHLQIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAE
NVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADA
VLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDYT
SFPEHHVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQP
ITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKQHLF
VERGGGDGIA
Download sequence
Identical sequences F7HDX6
ENSCJAP00000000368 XP_008981115.1.60252 XP_008981116.1.60252 ENSCJAP00000000368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]