SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000725 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000000725
Domain Number - Region: 387-424
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0497
Family Troponin I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000725   Gene: ENSCJAG00000000416   Transcript: ENSCJAT00000000775
Sequence length 465
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:17478791:17619705:-1 gene:ENSCJAG00000000416 transcript:ENSCJAT00000000775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVSYRQEVWLCERKGGQEDYREDGMDLGSDARASSQSNSTKVTPCSECKSSSSPGGSLDL
VSALEDYEERFPVYQKKVIDEWARDQRGYRDDRCPAREPGDLSARTRSGGGGGGRSATTA
MPPPVPNGNLHQHDPQDLRHNGNVVVAGRPSSSQGPRRAIQKPQPAGGRRDGRGPATGGL
CLQPPDGGTCVPEEPPVPPMDWEALEKHLAGLQFREQEVRNQGQARTNSTSAQKNERESI
RQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNLQICFVNDSGSDKDSDADDSKTE
TSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKKLQAEAKMALAMAKPMAKMQ
VEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMTIGQLQVIVNDLHSQIESLN
EELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEKMPAK
Download sequence
Identical sequences F6SE26
ENSCJAP00000000725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]