SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000804 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000804
Domain Number 1 Region: 22-74
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000523
Family Hairy Orange domain 0.0000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000804   Gene: ENSCJAG00000000477   Transcript: ENSCJAT00000000859
Sequence length 214
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:31849539:31851286:-1 gene:ENSCJAG00000000477 transcript:ENSCJAT00000000859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPLEERNVLWLSRENLTGDQGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPL
RVRLVSHLNNYASQREAASGAHAGLGHIPWGTAFGHHPHIAHPLLLPQNGHGNAGTTASP
TESLHQGRLASAHPEAPALRAPPSGSLGPVLPVVTSASKLSQPLLSSVASLSAFPFSFGS
FHLLSPNALSPSAPTQATNLGKPYRPWGTEIGAF
Download sequence
Identical sequences F6Q895
ENSCJAP00000000804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]